PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19963.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 709aa    MW: 78364.8 Da    PI: 7.5324
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19963.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28428479152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  KHN19963.1 428 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 479
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.257418499IPR003035RWP-RK domain
PfamPF020423.2E-24432479IPR003035RWP-RK domain
SuperFamilySSF542771.88E-21599695No hitNo description
PfamPF005645.8E-16608692IPR000270PB1 domain
PROSITE profilePS5174522.891608693IPR000270PB1 domain
SMARTSM006661.7E-23608693IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.6E-21608686No hitNo description
CDDcd064075.85E-38609692No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MVGKRWWIGP RENPGPSSSV KERLVIAVGY LKEYAKNSNL PIQVWVPERR SARAQPQDNI  60
YPYAAALLNG DAAAFQIQED WVHVNDQYWT PNVRFFRSHE YPRHLRTPGS LALPVFERGT  120
AMCLGVVEIL MPNNPPDLQC TVDFTSSTSS HHHNFIPPAV TVKGFDELYQ SALNGIVQVL  180
TCVCKAHNLP LALTWAPCIQ QAGKSGCGHS NDEMNYVSTV YAASFVADVE LLGFLEACSE  240
CHLLGGQGVV GTAFTTTKPC FANDITSFSK AEYPLAHHAN MFGLHAALGI PLRSASADFV  300
LEFFLPKDCH DTQDQKQLLN SLFMLVQQAC RSLHLVMEEE EELIALPSVV GKEMESSSWI  360
AHMMEAQQKG KGVSVSLEYL QEPKQEFKVT TNCSNTNEQV SVGVESTAAF CGRRVGRKSA  420
GDKRRTKAEK TISLPVLRQY FAGSLKDAAK SIGVCPTTLK RICRQHGITR WPSRKIKKVG  480
HSLRKLQLVI DSVQGAEGAI QIGSFYTSFP ELSSAANGVS ESSNINNNNN DNSKFFSEYN  540
QGQGATTFKS PTTSPCSQTT IVMSESQPLG LGASVQVVQE EAKHLAHQHL ESLPPLPQSS  600
TSVWNMGTFR VKATFGDEKI RFSLQPNWGF RDLQKEISRR FNLNEISNIQ LKYLDDAREW  660
VLLTCDADLE ECKGINTSSQ SQSRTIRLFL FHASPLNHAN AFPGTSPSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-166AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581076.20.0PREDICTED: protein NLP2-like isoform X1
TrEMBLA0A0B2QJ700.0A0A0B2QJ70_GLYSO; Protein NLP1
STRINGGLYMA04G00210.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.11e-174Nin-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]